Fit Peptide Co.,Limited Company Logo Fit Peptide Co.,Limited

FOXO4 D-Retro-Inverso(DRI) Peptide

See Larger Picture : FOXO4 D-Retro-Inverso(DRI) Peptide

Price

  • US$ 1000
Min Order Quantity 1 Box
Supply Ability 1000vials per month
Port A y port
Delivery Lead Time Parcel can be sent within 24hours upon the receipt of your payment,arrival within 3-5 working days
  • Share to :
  • Pinterest
Contact Now* Send an Inquiry to this supplier.
or
Start Order * Name your price

Browse by Category

Contact us

Fit Peptide Co.,Limited
[Hong Kong]

Address
Flat C 23/F Lcuky Plaza 315-321 Lockhart Road WAN CHAI Hongkong Hongkong
Phone
852-6555-7188
Contact name
Jenny

Quick Information

  • Brand Name: FIT
  • Place of Origin: China
  • Model Number : 95

Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRIpeptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging

Only for reseach use.


Price

  • Delivery Port : A y port

Packaging & Delivery

  • Packing :10vials/box
  • Delivery Lead Time : Parcel can be sent within 24hours upon the receipt of your payment,arrival within 3-5 working days
  • Supply Ability : 1000vials per month

Product Image

  • FOXO4 D-Retro-Inverso(DRI) Peptide image

Send an Inquiry to this supplier

Send an Inquiry to this supplier
* From
  To Jenny
Fit Peptide Co.,Limited
* Buying Product
- Please enter your specific buying item.
e.g. 42 inch LCD TV, leather executive chair
Category : Other Skin Care
* Message

Use English only Max. 2000 characters. (Min. 20)

Send